PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Carubv10023774m
Common NameCARUB_v10023774mg
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Camelineae; Capsella
Family GATA
Protein Properties Length: 289aa    MW: 32533.4 Da    PI: 8.7333
Description GATA family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Carubv10023774mgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1GATA55.76.6e-18212246135
             GATA   1 CsnCgttkTplWRrgpdgnktLCnaCGlyyrkkgl 35 
                      C++C tt Tp+WR+gp g  tLCnaCG+++r+ +l
  Carubv10023774m 212 CTHCETTRTPQWREGPHGRNTLCNACGVRFRSGRL 246
                      *******************************9885 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM004012.9E-17206256IPR000679Zinc finger, GATA-type
SuperFamilySSF577161.24E-14210269No hitNo description
Gene3DG3DSA:3.30.50.102.8E-14210243IPR013088Zinc finger, NHR/GATA-type
PROSITE profilePS5011412.202210242IPR000679Zinc finger, GATA-type
CDDcd002027.73E-16211268No hitNo description
PROSITE patternPS003440212237IPR000679Zinc finger, GATA-type
PfamPF003203.5E-16212246IPR000679Zinc finger, GATA-type
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0008270Molecular Functionzinc ion binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 289 aa     Download sequence    Send to blast
MNDGTWLPEE DFKGLADNFF DNLIEHIDDF PLEDIETADD EEDWKAGFQN LGPPPMDVLT  60
SMSSEFTCKG QRVRVQKTVP IVKQSSSSDV SSTVDGSPPD VKVSKLFQSS SPVSVVESTN  120
GSLLSQNQNR IERLAFLKKG IRSKRRRPTT LKFFQTLGAE MSQQFVPDES ESETYLSSEN  180
SAKKRKKIKS RPPQPSSYSP ELFNSDGTVR KCTHCETTRT PQWREGPHGR NTLCNACGVR  240
FRSGRLVPEY RPASSPTFIP AVHSNSHRKI IEMRRKDEGQ FDTRKIRA*
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1182186KKRKK
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_006294728.10.0hypothetical protein CARUB_v10023774mg
SwissprotQ9SKN61e-123GAT13_ARATH; Putative GATA transcription factor 13
TrEMBLR0FY110.0R0FY11_9BRAS; Uncharacterized protein
STRINGscaffold_401176.11e-149(Arabidopsis lyrata)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM16812589
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G28340.11e-113GATA transcription factor 13